Proteomiks


Ayşegül MURAT, Ege Üniversitesi Sağlık A.B.D., Doktora Öğrencisi

1990 yılında insan genom projesine başlanmasını sağlayan keşfetme merakı, 2003 yılında insan genom taslağının tamamlanmasıyla nihai hedefe (insan DNA’sının baz çifti dizilimi açığa çıkartarak bu dizi içerisinde yer alan genlerin yerini bulmamızı) ulaşmamızı sağladı. Proteomiks, insan genom projesi de dahil olmak üzere çeşitli genom projelerinin genetik bilgisinden büyük ölçüde yararlanan disiplinler arası bir alandır [1]. Proteomiks çalışması yapılabilmesi için o organizmanın genom çalışmasının tamamlanmış olması gerekir.

Resim 1: Genom çalışmalarından transkriptom, proteom ve metabolom çalışmalarını doğru gittikçe karmaşık artar ve bunlar bir araya gelerek sistem biyolojisini oluştururlar.



Günümüzde hemofili, renk körlüğü, meme kanseri gibi birçok kalıtsal hastalığın tanı ve tedavisinde genom bilgisinin kullanıldığını biliyoruz. Bugün bildiğimiz bir diğer gerçek ise artık bu ve benzeri hastalıklarla ilgili yapılan araştırmaların moleküler değil sistem boyutunda olması gerektiği. Her ne kadar genetik alt yapımız bir hastalığa yakınlığımızı genom seviyesinde açıklamaya çalışsa da bunu transkriptomik, proteomik, metabolomik (Resim 1) hatta epigenetik gibi diğer sistem biyolojisi alt çalışma alanlarıyla birlikte çalışarak hastalığı açıklamaya çalışmak daha doğru bir yaklaşım olacaktır. Bu yaklaşımın amacı moleküler seviyeden sistem seviyesine geçilerek bütünsel bir sistem açıklama çalışmaları yapmaktır. [2,3]


Santral Dogma


Temelde üç aşamadan oluşan, DNA’nın replikasyonu, transkripsiyonu ve translasyonuyla (Resim 2) devam eden hücredeki bilgi aktarım reaksiyonlarının tamamıdır.


Resim 2: Santral dogma mekanizması

GTGCATCTGACTCCT... şeklindeki DNA’daki bilgi, transkripsiyon mekanizmasıyla GUGCAUCUGACUCCU RNA’ya (Timin yerine Urasil) dönüştürülür. RNA’dan alınan bilgi ise her üçlü bazın bir amino asite dönüştürülmesiyle VHLPEEK...şeklinde yazılan proteinleri oluşturur.


Proteinler

Bir amino asitin amino grubuyla diğer amino asitin karboksil grubu arasında peptid bağı oluşturarak yan yana gelmesiyle peptit zinciri oluşturulur. 20 farklı amino asitten oluşan bu peptit zincirinin ikincil, üçüncül ve dördüncül katlanmalarıyla oluşturdukları kararlı yapı ise proteinleri oluşturur. Hücrede yapısal (aktin, tübülin ve miyolin), fonksiyonel (pepsin/tripsin gibi enzim), hücre sinyallenmesi ve ligand taşınması (IGF-insülin) gibi birçok hücresel işlevleri yerine getiren ve organizmanın yapıtaşını oluşturan makro moleküller proteinlerdir. Bir organizma veya sistemde üretilen veya modifiye edilen tüm proteinler proteomu oluşturur. Proteomiks ise herhangi bir organizmada; zaman, mekân, doku veya organizma düzeyinde proteinlerin yapı, fonksiyon ve etkileşimlerini inceleyen bilim dalına denir.

İç veya dış etkenler sonucu oluşan hastalıklarda, patojenler ve stres gibi durumlarda o an sistemde oluşan tüm biyolojik cevabı proteomiks çalışmayla inceleyerek, bu durumlara karşı aşı ve ilaç adayı geliştirilmesi, antijenlerin belirlenmesi, hastalığın hangi proteinlerin ifade seviyelerini etkilediğini bulabiliriz. [3]


Proteomiks Çalışmaları


Bir deneysel çalışmanın araştırmanın sorusu ve amacına göre proteomiks çalışmanın yapısı belirleniyor olsa da aşağıda sıralanan başlıklara cevabı proteomiks çalışmalarıyla arayabiliriz;

- Bir biyolojik süreçte ne zaman, nerede, ne kadar miktarda hangi proteinin ifade edildiğine,

- Deneysel etken sonucu (örneğin ilaç uygulanan bir hücrenin) kontrol grubuna göre hangi proteinin ifadesinin artıp azaldığına,

- Proteinde meydana gelen post translasyonel modifikasyonlarına (protein sentezlendikten sonra nasıl bir değişime uğradığı),

- Bir proteinin diğer proteinle nasıl bir etkileşim içerisinde olduğu,

- Bir metabolik yolak üzerinde hangi proteinlerin işlevsel olduğu,

- Stres koşulları oluşturulmuş bir canlıda bu strese karşı verilen cevabın ne olduğu,

- Enfeksiyonel hastalıklara karşı geliştirilen antikorların karakterizasyonu gibi birçok

sorunun cevabını bulmak için proteinle çalışmalar yapılmaktadır.


Protein Eldesi


Çalıştığımız molekülün doğası gereği tüm proteinleri tek analizde elde edebileceğimiz evrensel bir deneysel metot bulunmamaktadır. Çalışmak istediğimiz proteinlerimize uygun metadolojik bir yöntem belirleyerek işe başlamamız gerekiyor. Kromatografik, elektroforetik, santrifüj ilkesine dayalı teknikler ve IP (immünopresipitasyon) gibi yöntemler yardımıyla proteinler bulundukları kompleks matriksten izole edilebilirler. Bazı yöntemlerde proteinler geriye dönüşsüz olarak denatüre (doğal yapıyı bozma) edilirken bazılarında denatürasyon gerçekleşmez. Denatürasyonun gerçekleşmediği durumlara üçüncül ve dördüncül yapıların belirlenmesi ya da proteinin üç boyutlu yapı tayini örnek olarak verilebilir. Fakat tanımlayıcı deneysel çalışmalarda protein sekansının elde edilebilmesi için birincil yapıdaki polipeptit dizisinin açığa çıkartılması gerekir. Burada kullanılan denatürasyon yönteminin genel prensibi kararlı yapıda mevcut halde bulunan kimyasal bağların kırılmasıyla (kovalent bağların korunup disülfid bağların kırılması) gerçekleşmektedir. Üre, kuvvetli asit ve bazlar, mekanik stres, kaynatma gibi denatürasyon yöntemleri mevcuttur. Tuzla çöktürme gibi reversibl (geri dönüşümlü) denatürayonlarda olabilir. Denatüre olmuş proteinin tekrar eski haline gelmesi ise renatürasyon olarak tanımlanır [5,6].


Protein Analizi


Doku, hücre kültürü, kan, bakteri kültürü ve bitki kaynağından gelen bir örneğimiz olabilir. Fakat örneğimiz hangi kaynaktan gelirse gelsin ilk basamakta bu örneğimizin homojenize olması için lysis (parçalamamız) etmemiz gerekiyor. Lysis aşamasından sonra örnek içerisinde bulunan çalışmak istenilen proteinlerin saflaştırılması (ayırılma) gerekiyor. Saflaştırılan bu proteinler genelde SDS-Page ya da 2D jel elektroforezi ile moleküler ağırlıklarına/izoelektrik noktalarına göre ayrılarak kütle spektrometrisi ile analizleri yapılır. Bu kısım için temel laboratuvar çalışmalarında farklı protokoller vardır [7].


Mass Spectrometry (Kütle Spektromertrisi)


Bilinen materyalleri ölçmek, bir örnek içerisindeki bilinmeyen bileşikleri tanımlamak ve farklı moleküllerin yapısını ve kimyasal özelliklerini aydınlatmak için kullanılan güçlü bir analitik tekniktir. Numunenin parçalanma ile veya parçalanma olmaksızın gaz halinde iyonlara dönüştürülmesini içerir; bunlar daha sonra kütle/yük oranları (m/z) ve nispi bolluklarla karakterize edilir [8]. Ölçümün temel mantığı bir proteinin polipeptit zincirini oluşturan belirli amino asitlerin arasındaki bağın belirli kesim enzimleriyle kesilebilmesine ve bu proteine ait peptitlerin elde edilmesine dayanır. Örneğin; tripsin enzimi K ve R amino asitlerine karşı spesifik olarak kesim aktivitesi gösterir [9]. Keratin örneği için tüm R ve K amino asitlerinden kesilecek fragmentler oluşacaktır. Bu peptit fragmentlerin her biri MS ile ölçülerek kaydedilecek ve o örneğin bilinen protein database’ine karşı biyoinformatik algoritmalar kullanılarak analiz edilmesiyle o peptit fragmentine ai tprotein bulunacaktır.


>sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3

MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGS CG

RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNS...

MTCGSGFGGR

AFSCISACGPR

PGRCCITAAPYR

GLTGGFGSHSVCGGFR

....


Proteinleri meydana getiren peptitlerin tanımlanmasından kütle/yük oranlarını kullanan bu teknik için birden fazla kütle spektrometrisi cihazı vardır. En sık bilinenleri GC-MS, MALDİ- TOF, LC-MS/MS gibi olmasına rağmen daha farklı amaçlar için farklı firmaların farklı cihazları bulunmaktadır. Bunlardan proteomikse mevcut altın standart olan LC-MS/MS’te sıvı kromatografi sistemleri ile kütle spektrometri sistemleri bir arada çalışır. Çoğu peptit karışımı ön ayırma olmaksızın MS tarafından analiz edilemeyecek kadar karmaşıktır. Bu yüzden ilk olarak sıvı kromatografi prensiplerine uygun olarak LC kısmında peptitlerin ayırımı yapılır. Daha sonra ardışık kütle spektrometrisinin ilk MS işlemi için, bir öncü iyon (precursor ion) seçilmeden ve parçalanmadan önce bozulmamış peptilerin (tam MS) kütleleri ölçülerek kaydedilir. İkinci MS işleminde ise, genellikle argon veya azot ile çarpışmayla parçalanma indüklenir. Çarpışma sonucu oluşan fragmentler (parçalanma sonucu oluşmuş ilk peptitlere ait product iyonlar) bir MS/MS spektrumunda kaydedilir ve peptitdeki her amino asit için spesifik kütlesi ölçülerek fragment paterni ortaya çıkartılır [10, 11].


Resim 3: LC-MS/MS ile proteomiks analizinin iş akışı





Kaynakçalar

1. Hood, L., & Rowen, L. (2013). The human genome project: big science transforms biology and medicine. Genome medicine, 5(9), 79.

2. Barallobre-Barreiro, J., Chung, Y. L., & Mayr, M. (2013). Proteomics and metabolomics for mechanistic insights and biomarker discovery in cardiovascular disease. Revista Española de Cardiología (English Edition), 66(8), 657-661.

3. Tavassoly, I., Goldfarb, J., & Iyengar, R. (2018). Systems biology primer: the basic methods and approaches. Essays in biochemistry, 62(4), 487-500.

4. https://genius.com/Biology-genius-the-central-dogma-annotated

5. [Wang, K., & Spector, A. (2000). α‐Crystallin prevents irreversible protein

denaturation and acts cooperatively with other heat‐shock proteins to renature the

stabilized partially denatured protein in an ATP‐dependent manner. European Journal

of Biochemistry, 267(15), 4705-4712.

6. Tanford, C. (1968). Protein denaturation. In Advances in protein chemistry (Vol. 23,

pp. 121-282). Academic press.]

7. Bondos, S. E., & Bicknell, A. (2003). Detection and prevention of protein aggregation

before, during, and after purification. Analytical biochemistry, 316(2), 223-231.

8. http://premierbiosoft.com/tech_notes/mass-spectrometry.html

9. https://www.embl.de/proteomics/proteomics_services/instrumentation/index.html

10. Ren, J. L., Zhang, A. H., Kong, L., & Wang, X. J. (2018). Advances in mass

spectrometry-based metabolomics for investigation of metabolites. RSC

advances, 8(40), 22335-22350.

11. Altelaar, A. M., Munoz, J., & Heck, A. J. (2013). Next-generation proteomics:

towards an integrative view of proteome dynamics. Nature Reviews Genetics, 14(1), 35-48.

0 görüntüleme

Türkiye'nin Tek Popüler Genetik Bilim Dergisi

Bezelye Dergi ISSN: 2587-0173

Bizi Takip Et
  • Beyaz Facebook Simge
  • Beyaz Instagram Simge
  • White Twitter Icon
  • Icon-gmail
  • kisspng-white-logo-brand-pattern-three-d
  • images
  • medium
  • Dergilik
  • YouTube

© 2019 by Bezelye Dergi